Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhomboid protease glpG (glpG)

This Recombinant Rhomboid protease glpG (glpG) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Rhomboid protease glpG, EC= 3.4.21.105, Intramembrane serine protease

UniProt

Q83PV6

Expression Region

1-276

Origin

Shigella flexneri

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPA DPRYLAASWLAGHTGSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVM LWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLI SALLSGYMQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAG WFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NG2 Rabbit Polyclonal Antibody (BF750)
orb2408245 100 µL

NG2 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
GATA binding Protein 1 (globin transcription factor 1)
316900 100 µL

GATA binding Protein 1 (globin transcription factor 1)

Sign In for Pricing
View Details
GPR103 rabbit pAb Antibody
orb770605-01 50 μL

GPR103 rabbit pAb Antibody

Sign In for Pricing
View Details
GPR103 rabbit pAb Antibody
orb770605-02 100 µL

GPR103 rabbit pAb Antibody

Sign In for Pricing
View Details
SAMD8 ORF Vector (Human) (pORF)
ORF031946 1.0 µg DNA

SAMD8 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
AADACL1 Rabbit Polyclonal Antibody (APC)
orb994036 100 µL

AADACL1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details