Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhomboid protease glpG (glpG)

This Recombinant Rhomboid protease glpG (glpG) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Rhomboid protease glpG, EC= 3.4.21.105, Intramembrane serine protease

UniProt

Q83PV6

Expression Region

1-276

Origin

Shigella flexneri

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPA DPRYLAASWLAGHTGSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVM LWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLI SALLSGYMQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAG WFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli O157:H7 Guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase (gppA)
MBS1386898-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O157:H7 Guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase (gppA)

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 Guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase (gppA)
MBS1386898-02 0.02 mg (Yeast)

Recombinant Escherichia coli O157:H7 Guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase (gppA)

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 Guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase (gppA)
MBS1386898-03 0.1 mg (E-Coli)

Recombinant Escherichia coli O157:H7 Guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase (gppA)

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 Guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase (gppA)
MBS1386898-04 0.1 mg (Yeast)

Recombinant Escherichia coli O157:H7 Guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase (gppA)

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 Guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase (gppA)
MBS1386898-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli O157:H7 Guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase (gppA)

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 Guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase (gppA)
MBS1386898-06 0.02 mg (Mammalian-Cell)

Recombinant Escherichia coli O157:H7 Guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase (gppA)

Sign In for Pricing
View Details