Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Lipid phosphate phosphohydrolase 2 (Ppap2c)

This Recombinant Rat Lipid phosphate phosphohydrolase 2 (Ppap2c) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Lipid phosphate phosphohydrolase 2, EC= 3.1.3.4, PAP2-gamma, PAP2-G, Phosphatidate phosphohydrolase type 2c, Phosphatidic acid phosphatase 2c, PAP-2c, Short n

UniProt

Q8K593

Expression Region

1-276

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERRWVFVLLDVLCVLVASLPFIILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGV IITATVVLVSSGEAYLVYTDRLYSRSDFNNYVAAIYKVLGTFLFGAAVSQSLTDLAKYMI GRLRPSFLAVCDPDWSRVNCSGYVQVEVCRGSPANVTEARLSFYSGHSSFGMYCMLFLAL YVQARLCWKWARLLRPTVQFFLVAFAIYVGYTRVSDNKHHWSDVLVGLLQGALVACLTVC YVSDFFKSRPPQSCQENEESERKPSLSLTLTLGDRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JMJD4 (NM_001161465) Human Over-expression Lysate
LC431386 20 µg

JMJD4 (NM_001161465) Human Over-expression Lysate

Sign In for Pricing
View Details
D730039F16Rik (BC021771) Mouse Tagged ORF Clone
MG200145 10 µg

D730039F16Rik (BC021771) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (PCRP-TP53-2A10), 0.2mg/mL
BNUM1924-50 1x 50 µL

P53 Tumor Suppressor Protein (PCRP-TP53-2A10), 0.2mg/mL

Sign In for Pricing
View Details
CaMKII Recombinant Rabbit monoclonal Antibody
HA750150 100 µL

CaMKII Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Beta-xylosidase Microplate Assay Kit
RDSM092 100 Assays

Beta-xylosidase Microplate Assay Kit

Sign In for Pricing
View Details
ADO (C-term) Rabbit Polyclonal Antibody
AP50095PU-N 400 µL

ADO (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details