Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Lipid phosphate phosphohydrolase 2 (Ppap2c)

This Recombinant Rat Lipid phosphate phosphohydrolase 2 (Ppap2c) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Lipid phosphate phosphohydrolase 2, EC= 3.1.3.4, PAP2-gamma, PAP2-G, Phosphatidate phosphohydrolase type 2c, Phosphatidic acid phosphatase 2c, PAP-2c, Short n

UniProt

Q8K593

Expression Region

1-276

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERRWVFVLLDVLCVLVASLPFIILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGV IITATVVLVSSGEAYLVYTDRLYSRSDFNNYVAAIYKVLGTFLFGAAVSQSLTDLAKYMI GRLRPSFLAVCDPDWSRVNCSGYVQVEVCRGSPANVTEARLSFYSGHSSFGMYCMLFLAL YVQARLCWKWARLLRPTVQFFLVAFAIYVGYTRVSDNKHHWSDVLVGLLQGALVACLTVC YVSDFFKSRPPQSCQENEESERKPSLSLTLTLGDRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tau Recombinant Rabbit monoclonal Antibody
HA723913 100 µL

Tau Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
COMMD8 (NM_017845) Human Recombinant Protein
TP305085 20 µg

COMMD8 (NM_017845) Human Recombinant Protein

Sign In for Pricing
View Details
AMPK alpha 1 (PRKAA1) Rabbit Polyclonal Antibody
AP02704PU-S 50 µL

AMPK alpha 1 (PRKAA1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant THBS1 Antibody
RC-5946-01 50 μL

Recombinant THBS1 Antibody

Sign In for Pricing
View Details
Recombinant THBS1 Antibody
RC-5946-02 100 µL

Recombinant THBS1 Antibody

Sign In for Pricing
View Details
Recombinant THBS1 Antibody
RC-5946-03 1 mL

Recombinant THBS1 Antibody

Sign In for Pricing
View Details