Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Lipid phosphate phosphohydrolase 2 (Ppap2c)

This Recombinant Rat Lipid phosphate phosphohydrolase 2 (Ppap2c) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Lipid phosphate phosphohydrolase 2, EC= 3.1.3.4, PAP2-gamma, PAP2-G, Phosphatidate phosphohydrolase type 2c, Phosphatidic acid phosphatase 2c, PAP-2c, Short n

UniProt

Q8K593

Expression Region

1-276

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERRWVFVLLDVLCVLVASLPFIILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGV IITATVVLVSSGEAYLVYTDRLYSRSDFNNYVAAIYKVLGTFLFGAAVSQSLTDLAKYMI GRLRPSFLAVCDPDWSRVNCSGYVQVEVCRGSPANVTEARLSFYSGHSSFGMYCMLFLAL YVQARLCWKWARLLRPTVQFFLVAFAIYVGYTRVSDNKHHWSDVLVGLLQGALVACLTVC YVSDFFKSRPPQSCQENEESERKPSLSLTLTLGDRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NABP1 activation kit by CRISPRa
GA112182 1 Kit

Human NABP1 activation kit by CRISPRa

Sign In for Pricing
View Details
Speer4a Mouse Gene Knockout Kit (CRISPR)
KN516584 1 Kit

Speer4a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CRLS1 (NM_001127458) Human Over-expression Lysate
LC426793 20 µg

CRLS1 (NM_001127458) Human Over-expression Lysate

Sign In for Pricing
View Details
KCNA5 Human Gene Knockout Kit (CRISPR)
KN419793 1 Kit

KCNA5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
APOL2 Antibody
8C14540-AAT 50 µg

APOL2 Antibody

Sign In for Pricing
View Details
Recombinant Human BCL2 Protein (Trx Tag)
PDEH100541-01 20 µg

Recombinant Human BCL2 Protein (Trx Tag)

Sign In for Pricing
View Details