Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhomboid protease glpG (glpG)

This Recombinant Rhomboid protease glpG (glpG) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Rhomboid protease glpG, EC= 3.4.21.105, Intramembrane serine protease

UniProt

Q8X6Z6

Expression Region

1-276

Origin

Escherichia coli O157:H7

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPA DPRYLAASWQAGHTGSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVM LWLAWPFDPALKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAG WFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rbm24 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3324703 1.0 µg DNA

Rbm24 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Schisantherin E
465948-01 2.5 mg

Schisantherin E

Sign In for Pricing
View Details
Schisantherin E
465948-02 5 mg

Schisantherin E

Sign In for Pricing
View Details
HMCN2 CRISPR Knock Out 293T Cell Line (Human)
23481141 1x 10^6 Cells / 1.0 mL

HMCN2 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
DDX47 Antibody
MBS9434673-01 0.1 mL

DDX47 Antibody

Sign In for Pricing
View Details
DDX47 Antibody
MBS9434673-02 5x 0.1 mL

DDX47 Antibody

Sign In for Pricing
View Details