Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Insulin-induced gene 1 protein (INSIG1)

This Recombinant Bovine Insulin-induced gene 1 protein (INSIG1) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

Insulin-induced gene 1 protein, INSIG-1

UniProt

A0JNC3

Expression Region

1-276

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPRLDDHLWRGPCAKGTKHRSHPRASARGLVAKAGEMINSSGSGPSLLAAHGALGTDPAH GPQSAGVGGQGSSSHVNSWHHHLVQRSLVLFSVGVVLALVLNLLQVQRNVTLFPDEVIAT IFSSAWWVPPCCGTAAAVVGLLYPCIDSHLGEPHKFKREWASVMRCVAVFVGINHASAKL DFANNVQLSLTLAALSLGLWWTFDRSRSGLGLGITIAFLATLITQLLVYNGVYQYTSPDF LYIRSWLPCIFFSGGVTVGNIGRQLAMGVPEKPHSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL
BNC040009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL
BNC940218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF740 conjugate, 0.1mg/mL
BNC740193-500 1x 500 µL

CD86 (BU63), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF594 conjugate, 0.1mg/mL
BNC940342-100 1x 100 µL

CD43 (84-3C1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL
BNC040050-500 1x 500 µL

IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL
BNC472853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details