Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechocystis sp. ATP synthase subunit a (atpB)

This Recombinant Synechocystis sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

P27178

Expression Region

1-276

Origin

Synechocystis sp. (strain PCC 6803 / Kazusa)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQGSLSWLLRFVEGQQLSSLPRQSHRITMLAGLSVLNLFPLAALEVGQQWYWEIGNLKLH GQTFATSWFVILLLVIASLAATRNVQRVPSGIQNLMEYVLEFLRDLARNQLGEKEYRPWL PFIGTLFLFIFVSNWSGALLPWKLIHIPDGAELAAPTNDINTTVALALLTSLAYFYAGLR KKGLGYFANYVQPIPVLLPIKILEDFTKPLSLSFRLFGNILADELVVAVLVLLVPLLVPL PLMALGLFTSAIQALVFATLAGAYIHEAIESEGEEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Endometrium
CS629737 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
Mouse MMP-3 (Matrix Metalloproteinase 3) ELISA Kit
E-EL-M0626-01 24 Tests

Mouse MMP-3 (Matrix Metalloproteinase 3) ELISA Kit

Sign In for Pricing
View Details
Mouse MMP-3 (Matrix Metalloproteinase 3) ELISA Kit
E-EL-M0626-02 48 Tests

Mouse MMP-3 (Matrix Metalloproteinase 3) ELISA Kit

Sign In for Pricing
View Details
Mouse MMP-3 (Matrix Metalloproteinase 3) ELISA Kit
E-EL-M0626-03 96 Tests

Mouse MMP-3 (Matrix Metalloproteinase 3) ELISA Kit

Sign In for Pricing
View Details
8-Nonadecanone
TRC-N649210-25MG 25 mg

8-Nonadecanone

Sign In for Pricing
View Details
SAMSN1 Mouse Monoclonal Antibody [Clone ID: OTI7C12]
CF808901 100 µg

SAMSN1 Mouse Monoclonal Antibody [Clone ID: OTI7C12]

Sign In for Pricing
View Details