Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechocystis sp. ATP synthase subunit a (atpB)

This Recombinant Synechocystis sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-276.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

P27178

Expression Region

1-276

Origin

Synechocystis sp. (strain PCC 6803 / Kazusa)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQGSLSWLLRFVEGQQLSSLPRQSHRITMLAGLSVLNLFPLAALEVGQQWYWEIGNLKLH GQTFATSWFVILLLVIASLAATRNVQRVPSGIQNLMEYVLEFLRDLARNQLGEKEYRPWL PFIGTLFLFIFVSNWSGALLPWKLIHIPDGAELAAPTNDINTTVALALLTSLAYFYAGLR KKGLGYFANYVQPIPVLLPIKILEDFTKPLSLSFRLFGNILADELVVAVLVLLVPLLVPL PLMALGLFTSAIQALVFATLAGAYIHEAIESEGEEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM86B2 (NM_001137610) Human Over-expression Lysate
LY427947 100 µg

FAM86B2 (NM_001137610) Human Over-expression Lysate

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/2754), CF640R conjugate, 0.1mg/mL
BNC402754-500 1x 500 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/2754), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 (PECAM1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H6]
TA504773AM 100 µL

CD31 (PECAM1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H6]

Sign In for Pricing
View Details
Bis(acetonitrile)dichloropalladium(II)
TRC-B399850-2.5G 2.5 g

Bis(acetonitrile)dichloropalladium(II)

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD25 Antibody[BC96]
E-AB-F1194H-01 20 Tests

PE/Cyanine7 Anti-Human CD25 Antibody[BC96]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD25 Antibody[BC96]
E-AB-F1194H-02 100 Tests

PE/Cyanine7 Anti-Human CD25 Antibody[BC96]

Sign In for Pricing
View Details