Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactobacillus helveticus Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

This Recombinant Lactobacillus helveticus Energy-coupling factor transporter transmembrane protein EcfT (ecfT) spans the amino acid sequence from region 1-277.

Product Specifications

Product Name Alternative

Energy-coupling factor transporter transmembrane protein EcfT, ECF transporter T component EcfT

UniProt

A8YXN4

Expression Region

1-277

Origin

Lactobacillus helveticus (strain DPC 4571)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMGLRKMCRGSLMSKIIIGRYIPGDSLVYKMDPRGKLLITILFIWAIFLANNPITYAIIT FFCFLAIIATGLKARVFWNGVKPLIGLIFFTSLLQLFFMTGGHVFWHWWIFSISSYGVEN AIYIFIRFTLIILISTVMTVTTMPLEIADAMEWLLKPLKIFKVPVDEIALVISIALRFVP TLFDETLKIMNAQRSRGADFNDGGLIKRAKAIAPILVPLFIHSLETAIDLSTAMESRGYR GSAGRTKYRVLNWSKYDLISLAYFILLVGLLLIFRTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NANS (Biotin)
569725-01 50 µg

NANS (Biotin)

Sign In for Pricing
View Details
NANS (Biotin)
569725-02 100 µg

NANS (Biotin)

Sign In for Pricing
View Details
CH25H Protein Vector (Human) (pPM-C-HA)
PV009231 500 ng

CH25H Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Canine betaIII-tubulin ELISA Kit
MBS7271741-01 48 Well

Canine betaIII-tubulin ELISA Kit

Sign In for Pricing
View Details
Canine betaIII-tubulin ELISA Kit
MBS7271741-02 96 Well

Canine betaIII-tubulin ELISA Kit

Sign In for Pricing
View Details
Canine betaIII-tubulin ELISA Kit
MBS7271741-03 5x 96 Well

Canine betaIII-tubulin ELISA Kit

Sign In for Pricing
View Details