Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactobacillus helveticus Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

This Recombinant Lactobacillus helveticus Energy-coupling factor transporter transmembrane protein EcfT (ecfT) spans the amino acid sequence from region 1-277.

Product Specifications

Product Name Alternative

Energy-coupling factor transporter transmembrane protein EcfT, ECF transporter T component EcfT

UniProt

A8YXN4

Expression Region

1-277

Origin

Lactobacillus helveticus (strain DPC 4571)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMGLRKMCRGSLMSKIIIGRYIPGDSLVYKMDPRGKLLITILFIWAIFLANNPITYAIIT FFCFLAIIATGLKARVFWNGVKPLIGLIFFTSLLQLFFMTGGHVFWHWWIFSISSYGVEN AIYIFIRFTLIILISTVMTVTTMPLEIADAMEWLLKPLKIFKVPVDEIALVISIALRFVP TLFDETLKIMNAQRSRGADFNDGGLIKRAKAIAPILVPLFIHSLETAIDLSTAMESRGYR GSAGRTKYRVLNWSKYDLISLAYFILLVGLLLIFRTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPLA2 (E-1) : m-IgG1 BP-HRP Bundle
sc-542245 1 Kit

CPLA2 (E-1) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
RPS11P2 AAV Vector (Human) (CMV)
42046101 1 µg

RPS11P2 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Phospho-FGFR1+FGFR2 (Tyr463/Tyr466) Polyclonal Antibody, PE Conjugated
bs-5326R-PE-01 20 µL

Phospho-FGFR1+FGFR2 (Tyr463/Tyr466) Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Phospho-FGFR1+FGFR2 (Tyr463/Tyr466) Polyclonal Antibody, PE Conjugated
bs-5326R-PE-02 100 µL

Phospho-FGFR1+FGFR2 (Tyr463/Tyr466) Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Recombinant Human UTF1 Protein
E30P3339 20 µg

Recombinant Human UTF1 Protein

Sign In for Pricing
View Details
TREML2 Recombinant Protein
91-827 0.05 mg

TREML2 Recombinant Protein

Sign In for Pricing
View Details