Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactobacillus helveticus Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

This Recombinant Lactobacillus helveticus Energy-coupling factor transporter transmembrane protein EcfT (ecfT) spans the amino acid sequence from region 1-277.

Product Specifications

Product Name Alternative

Energy-coupling factor transporter transmembrane protein EcfT, ECF transporter T component EcfT

UniProt

A8YXN4

Expression Region

1-277

Origin

Lactobacillus helveticus (strain DPC 4571)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMGLRKMCRGSLMSKIIIGRYIPGDSLVYKMDPRGKLLITILFIWAIFLANNPITYAIIT FFCFLAIIATGLKARVFWNGVKPLIGLIFFTSLLQLFFMTGGHVFWHWWIFSISSYGVEN AIYIFIRFTLIILISTVMTVTTMPLEIADAMEWLLKPLKIFKVPVDEIALVISIALRFVP TLFDETLKIMNAQRSRGADFNDGGLIKRAKAIAPILVPLFIHSLETAIDLSTAMESRGYR GSAGRTKYRVLNWSKYDLISLAYFILLVGLLLIFRTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal IL-20 Antibody (017) [Alexa Fluor 594]
NBP2-90161AF594 0.1 mL

Rabbit Monoclonal IL-20 Antibody (017) [Alexa Fluor 594]

Sign In for Pricing
View Details
Transaldolase antibody (FITC)
60R-1996 0.1 mg

Transaldolase antibody (FITC)

Sign In for Pricing
View Details
NRN1L Protein Lysate (Human) with C-Ha Tag
32176031 100 µg

NRN1L Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
MYO10 Rabbit Polyclonal Antibody
53361-01 50 µL

MYO10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MYO10 Rabbit Polyclonal Antibody
53361-02 100 µL

MYO10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RUFY1 antibody
70R-2737 50 ug

RUFY1 antibody

Sign In for Pricing
View Details