Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arthrobacter chlorophenolicus Undecaprenyl-diphosphatase (uppP)

This Recombinant Arthrobacter chlorophenolicus Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-277.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

B8H8K7

Expression Region

1-277

Origin

Arthrobacter chlorophenolicus (strain A6 / ATCC 700700 / DSM 12829 / JCM 12360)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNWFEVALLGLVQGLTEFLPISSSAHLRIVGQFLPNAEDPGAAFTAITQLGTETAVVVYF WRDIVRIVKAWAGSLAGKVSRQDPDARMGWLVILGSLPIIVLGLLFQDQIESVLRSMWIV ATMLIVFGLILAVADAVGKQERDLTQLTYKHGILYGFAQAMALIPGVSRSGGTITAGLLM GYTREAAARYSFLLAIPAVFGSGLYQLYKVVSKDGITGPYGLPETALATVIAFVVGYVII GWFLKFVSTRSYRLFVWYRIFLGLALYLLLGFGVISA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNN1 Rabbit Polyclonal Antibody
TA372845 100 µL

KCNN1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLC5A11 Polyclonal Antibody
E-AB-90592-01 60 µL

SLC5A11 Polyclonal Antibody

Sign In for Pricing
View Details
SLC5A11 Polyclonal Antibody
E-AB-90592-02 120 µL

SLC5A11 Polyclonal Antibody

Sign In for Pricing
View Details
SLC5A11 Polyclonal Antibody
E-AB-90592-03 200 µL

SLC5A11 Polyclonal Antibody

Sign In for Pricing
View Details
Shisa6 Mouse Gene Knockout Kit (CRISPR)
KN515754 1 Kit

Shisa6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RbAp46 (RBBP7) Human Gene Knockout Kit (CRISPR)
KN417969 1 Kit

RbAp46 (RBBP7) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details