Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arthrobacter chlorophenolicus Undecaprenyl-diphosphatase (uppP)

This Recombinant Arthrobacter chlorophenolicus Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-277.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

B8H8K7

Expression Region

1-277

Origin

Arthrobacter chlorophenolicus (strain A6 / ATCC 700700 / DSM 12829 / JCM 12360)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNWFEVALLGLVQGLTEFLPISSSAHLRIVGQFLPNAEDPGAAFTAITQLGTETAVVVYF WRDIVRIVKAWAGSLAGKVSRQDPDARMGWLVILGSLPIIVLGLLFQDQIESVLRSMWIV ATMLIVFGLILAVADAVGKQERDLTQLTYKHGILYGFAQAMALIPGVSRSGGTITAGLLM GYTREAAARYSFLLAIPAVFGSGLYQLYKVVSKDGITGPYGLPETALATVIAFVVGYVII GWFLKFVSTRSYRLFVWYRIFLGLALYLLLGFGVISA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS6KC1 Polyclonal Antibody
E-AB-90681-01 60 µL

RPS6KC1 Polyclonal Antibody

Sign In for Pricing
View Details
RPS6KC1 Polyclonal Antibody
E-AB-90681-02 120 µL

RPS6KC1 Polyclonal Antibody

Sign In for Pricing
View Details
RPS6KC1 Polyclonal Antibody
E-AB-90681-03 200 µL

RPS6KC1 Polyclonal Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Mouse IgG3,  5nm
GM-303-5 1 mL

Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Mouse IgG3, 5nm

Sign In for Pricing
View Details
Thermo Shaker Incubator BSTH-102
BSTH-102 1 Unit

Thermo Shaker Incubator BSTH-102

Sign In for Pricing
View Details
GNAZ (NM_002073) Human Over-expression Lysate
LY400764 100 µg

GNAZ (NM_002073) Human Over-expression Lysate

Sign In for Pricing
View Details