Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Multiple sugar-binding transport system permease protein msmG (msmG)

This Recombinant Multiple sugar-binding transport system permease protein msmG (msmG) spans the amino acid sequence from region 1-277.

Product Specifications

Product Name Alternative

Multiple sugar-binding transport system permease protein msmG

UniProt

Q00751

Expression Region

1-277

Origin

Streptococcus mutans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKEEKINYFWKYVLLTVGGILILIPLMVTVFSSFKKTKDIMNHFFAFPNPITLDNYKRL LADGVGGYFWNSTVITVLSVLVVMLFIPAAAYSIARNMSRRKAFNIMYSLLILGIFVPFQ VIMIPITVMMSKLGLANMWGLIILYLTYAIPQTLFLYVGYIKLSVPDSLDEAAEIDGADK LTTYRKIIFPMLKPMHATTLIINALWFWNDFMLPLLILNKDSSMWTLPLFQYNYSGQYFN DYGPSFASYIVGIITITIVYLIFQKHIIAGMSNGAVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Renal Proximal Tubule Epithelial Cell RNA (HRPTEpC RNA), Adult
930-R25a 25 µg

Renal Proximal Tubule Epithelial Cell RNA (HRPTEpC RNA), Adult

Sign In for Pricing
View Details
1- (2-Bromo-3-ethoxy-6-fluorophenyl) ethanol
PC1016887-01 250 mg

1- (2-Bromo-3-ethoxy-6-fluorophenyl) ethanol

Sign In for Pricing
View Details
1- (2-Bromo-3-ethoxy-6-fluorophenyl) ethanol
PC1016887-02 500 mg

1- (2-Bromo-3-ethoxy-6-fluorophenyl) ethanol

Sign In for Pricing
View Details
1- (2-Bromo-3-ethoxy-6-fluorophenyl) ethanol
PC1016887-03 1 g

1- (2-Bromo-3-ethoxy-6-fluorophenyl) ethanol

Sign In for Pricing
View Details
1- (2-Bromo-3-ethoxy-6-fluorophenyl) ethanol
PC1016887-04 5 g

1- (2-Bromo-3-ethoxy-6-fluorophenyl) ethanol

Sign In for Pricing
View Details
LARP1 Knockout Hela Polyclonal Cells
ARG8219 1 Million

LARP1 Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details