Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Multiple sugar-binding transport system permease protein msmG (msmG)

This Recombinant Multiple sugar-binding transport system permease protein msmG (msmG) spans the amino acid sequence from region 1-277.

Product Specifications

Product Name Alternative

Multiple sugar-binding transport system permease protein msmG

UniProt

Q00751

Expression Region

1-277

Origin

Streptococcus mutans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKEEKINYFWKYVLLTVGGILILIPLMVTVFSSFKKTKDIMNHFFAFPNPITLDNYKRL LADGVGGYFWNSTVITVLSVLVVMLFIPAAAYSIARNMSRRKAFNIMYSLLILGIFVPFQ VIMIPITVMMSKLGLANMWGLIILYLTYAIPQTLFLYVGYIKLSVPDSLDEAAEIDGADK LTTYRKIIFPMLKPMHATTLIINALWFWNDFMLPLLILNKDSSMWTLPLFQYNYSGQYFN DYGPSFASYIVGIITITIVYLIFQKHIIAGMSNGAVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIPK Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-9711R-PE-Cy5.5 100 µL

LIPK Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Sh2d1b2 Mouse qPCR Primer Pair (NM_001033499)
MP215347 200 Reactions

Sh2d1b2 Mouse qPCR Primer Pair (NM_001033499)

Sign In for Pricing
View Details
Hibarrier Paper,blue Color
LA1062-100NO 1 unit

Hibarrier Paper,blue Color

Sign In for Pricing
View Details
CD144/VE Cadherin Polyclonal Antibody APC Conjugated
orb1541389 100 µL

CD144/VE Cadherin Polyclonal Antibody APC Conjugated

Sign In for Pricing
View Details
CD40 Recombinant Protein His Tag Lyophilized 100UG
ICD40RHISLY100UG 100 µg

CD40 Recombinant Protein His Tag Lyophilized 100UG

Sign In for Pricing
View Details
Anti-Murine MDC Rabbit Polyclonal Antibody
TA328537 100 µg

Anti-Murine MDC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details