Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Multiple sugar-binding transport system permease protein msmG (msmG)

This Recombinant Multiple sugar-binding transport system permease protein msmG (msmG) spans the amino acid sequence from region 1-277.

Product Specifications

Product Name Alternative

Multiple sugar-binding transport system permease protein msmG

UniProt

Q00751

Expression Region

1-277

Origin

Streptococcus mutans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKEEKINYFWKYVLLTVGGILILIPLMVTVFSSFKKTKDIMNHFFAFPNPITLDNYKRL LADGVGGYFWNSTVITVLSVLVVMLFIPAAAYSIARNMSRRKAFNIMYSLLILGIFVPFQ VIMIPITVMMSKLGLANMWGLIILYLTYAIPQTLFLYVGYIKLSVPDSLDEAAEIDGADK LTTYRKIIFPMLKPMHATTLIINALWFWNDFMLPLLILNKDSSMWTLPLFQYNYSGQYFN DYGPSFASYIVGIITITIVYLIFQKHIIAGMSNGAVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NT-4 Recombinant Protein
PROTP34130-500ug 500 µg

Human NT-4 Recombinant Protein

Sign In for Pricing
View Details
NativeExtract™ Human SSTR5 Membrane Protein (Full length, Super Nanodisc)
S01YF-1023-KX43 10 μg

NativeExtract™ Human SSTR5 Membrane Protein (Full length, Super Nanodisc)

Sign In for Pricing
View Details
ML133 HCl
M17888-01 1 g

ML133 HCl

Sign In for Pricing
View Details
ML133 HCl
M17888-02 5 mg

ML133 HCl

Sign In for Pricing
View Details
ML133 HCl
M17888-03 10 mg

ML133 HCl

Sign In for Pricing
View Details
ML133 HCl
M17888-04 25 mg

ML133 HCl

Sign In for Pricing
View Details