Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Rhomboid protease glpG (glpG)

This Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Rhomboid protease glpG (glpG) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Rhomboid protease glpG, EC= 3.4.21.105, Intramembrane serine protease

UniProt

A1JSF0

Expression Region

1-278

Origin

Yersinia enterocolitica serotype O:8 / biotype 1B (strain 8081)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVRVIAISNLRLAQAFVDYMATRHVALEVKPDSQGAEIWLTDDEQLPQVQHELEQFLLDP LNPRYQAASWQSGNLHSNLPYQRFSYLQTLRSQAGPLTLSVMVLCIAIYILMQIVGDGAV MSWLAWPRDNSQYLQIWRWVSHAFLHFSLLHILFNLMWWWYLAGQMEKRLGTGKLLVLTI VSALFSGWGQSLFSGVNFGGLSGVVYALMGYVWLTGERAPERGISLPRGLMAFSVLWLVA GYFDILGLSIANAAHVSGLIIGLLMAFWDTRNSAKTTQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL
BNC880218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL
BNC940029-500 1x 500 µL

Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF647 conjugate, 0.1mg/mL
BNC470189-100 1x 100 µL

CD74 (BU45), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL
BNC740181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL
BNC680304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF770 conjugate, 0.1mg/mL
BNC700164-500 1x 500 µL

CD28 (204.12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details