Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serratia proteamaculans Rhomboid protease glpG (glpG)

This Recombinant Serratia proteamaculans Rhomboid protease glpG (glpG) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Rhomboid protease glpG, EC= 3.4.21.105, Intramembrane serine protease

UniProt

A8GKU2

Expression Region

1-278

Origin

Serratia proteamaculans (strain 568)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVRVIAVSNPRLAQAFVDYMTTQGIELRVHNTGEAAEIWLADDSHLEQVQHELQQFLIDP LNSRYRAASWQAGNTDADLHYQGFSYLQTLRSKAGPLTLGVMALCIVVYILMQILGDDTL MYWLSWPQDSSQYLQLWRWVSHAFLHFSLLHITFNLLWWWYLGGPLEKRLGSGKLFVLAV VSAFFSGWAQSLFSGALFGGLSGVVYALMGYCWLSGERAPERGLMLPRGLMVFSVLWLVA GYFDILGMSIANAAHVAGLVLGLLMAFWDTRHRAHNEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD66 (CEA) (COL-1), CF594 conjugate, 0.1mg/mL
BNC940002-100 1x 100 µL

CD66 (CEA) (COL-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P34 / cdk1 (POH-1), CF640R conjugate, 0.1mg/mL
BNC400853-100 1x 100 µL

P34 / cdk1 (POH-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (C66/195), CF405S conjugate, 0.1mg/mL
BNC040195-100 1x 100 µL

CD66 (CEA) (C66/195), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SIGLEC1 / CD169 / Sialoadhesin (HSn 7D2), CF568 conjugate, 0.1mg/mL
BNC682843-100 1x 100 µL

SIGLEC1 / CD169 / Sialoadhesin (HSn 7D2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/760 + KRT7/903), CF488A conjugate, 0.1mg/mL
BNC880906-100 1x 100 µL

Cytokeratin 7 (KRT7/760 + KRT7/903), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / EMA / CD227 (Epithelial Marker) (rMUC1/960), CF568 conjugate, 0.1mg/mL
BNC680960-500 1x 500 µL

MUC1 / EMA / CD227 (Epithelial Marker) (rMUC1/960), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details