Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Exiguobacterium sibiricum Undecaprenyl-diphosphatase (uppP)

This Recombinant Exiguobacterium sibiricum Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

B1YIX1

Expression Region

1-278

Origin

Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIIELLKALLLGFIEGMTEFAPVSSTGHMIIVDDMWLQTTDFLGKYSANTFKIVIQLGS ILAVIVVFWKRLFSLIGLYKIEGEHDASGTHKLKLRHVLIGLLPAAVLGLLFEDFIDENL FSIDTVIIGLAAGAILMIAADKLGPKEPKTTSLDQISYRQAALVGLFQCISLWPGFSRSG STISGGVFLGMNHRTAADFTFIMAVPIMFGASALSLVKNWEYINVGDLGFYVVGFIASFG FALLSIRFFLKLINKIKLVPFAIYRLVLAAVLAVIVYM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF594 conjugate, 0.1mg/mL
BNC940333-500 1x 500 µL

CD8 (RIV11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RB (PTPRC/1132), CF647 conjugate, 0.1mg/mL
BNC471132-100 1x 100 µL

CD45RB (PTPRC/1132), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (K8/383), CF488A conjugate, 0.1mg/mL
BNC880383-100 1x 100 µL

Cytokeratin 8 (K8/383), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1892), CF405S conjugate, 0.1mg/mL
BNC041892-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/1892), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF647 conjugate, 0.1mg/mL
BNC470017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (135-4C5), CF488A conjugate, 0.1mg/mL
BNC880172-100 1x 100 µL

CD45 / LCA (135-4C5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details