Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aggregatibacter aphrophilus UPF0761 membrane protein NT05HA_1801 (NT05HA_1801)

This Recombinant Aggregatibacter aphrophilus UPF0761 membrane protein NT05HA_1801 (NT05HA_1801) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

UPF0761 membrane protein NT05HA_1801

UniProt

C6AQL9

Expression Region

1-278

Origin

Aggregatibacter aphrophilus (strain NJ8700) (Haemophilus aphrophilus)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIEWKTFCTIFWQRFNQNKLTQAAGYLTYSTMLAIVPLIMVVFSIFSAFPVFNEVTGALK EFIFTNFAPSASDVVGQYIDEFVNNSKQMSAVGIISLIVVALMLINSIDRTLNSIWHDTS TRPIFTSFAIYWLILTLGPLLVGTSIAASAYVKTMFENASGFSFGLKLLSFVPFLSTWFI FTVIYMVVPNKKVSIKHSAAGALIAAVFFTLGKQAFAWYIVTFPSYQLIYGAMATLPIML LWIQLSWTFVLLGAQLAAVLAEVRSEKMINLEQIEETK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL
BNC940040-500 1x 500 µL

CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Mantle Cell Lymphoma Marker) (CD5/2418), CF405S conjugate, 0.1mg/mL
BNC042418-500 1x 500 µL

CD5 (Mantle Cell Lymphoma Marker) (CD5/2418), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL
BNC051037-100 1x 100 µL

CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), 1mg/mL
BNUM1429-50 1x 50 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), 1mg/mL

Sign In for Pricing
View Details
MUC16 / CA125 (Ovarian Carcinoma Marker) (MUC16/1860), CF594 conjugate, 0.1mg/mL
BNC941860-500 1x 500 µL

MUC16 / CA125 (Ovarian Carcinoma Marker) (MUC16/1860), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Moesin (rMSN/492), CF594 conjugate, 0.1mg/mL
BNC942307-100 1x 100 µL

Moesin (rMSN/492), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details