Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Maltodextrin transport system permease protein mdxG (mdxG)

This Recombinant Bacillus subtilis Maltodextrin transport system permease protein mdxG (mdxG) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Maltodextrin transport system permease protein mdxG

UniProt

O06991

Expression Region

1-278

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNASTARMLNKICTYLFLTLLSIVIIYPLLITASSAFRVGNSAAFQLDFSGSWTLDHFKR LFDETLYLNWYSNTLVIALSVMVLQVTIVTLAGYSYSRYRFAGRKKSLIFFLIIQMVPTM AALTAFYVLAMLIGALDQYWFLTAIYIGGGIPMNTWLMKGYFDTVPREIDEAARIDGAGH LRIFASIVLPLVKPMLAVQALWAFMAPFGDYLLTKFLLRSPERLTIAVGLQSFISNPQQQ KVALFAAGAILAALPICVLFFFLQKNFVSGLTAGGTKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF594 conjugate, 0.1mg/mL
BNC941073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL
BNC402216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL
BNC680218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF647 conjugate, 0.1mg/mL
BNC470158-500 1x 500 µL

Cytokeratin 17 (E3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL
BNC680029-500 1x 500 µL

Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL
BNC400806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details