Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Frankia sp. Undecaprenyl-diphosphatase 3 (uppP3)

This Recombinant Frankia sp. Undecaprenyl-diphosphatase 3 (uppP3) spans the amino acid sequence from region 1-278.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase 3, EC= 3.6.1.27, Bacitracin resistance protein 3, Undecaprenyl pyrophosphate phosphatase 3

UniProt

Q2J4I7

Expression Region

1-278

Origin

Frankia sp. (strain CcI3)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVLEAVFLGAVEGLTEFLPVSSTGHLTILEKLLGHDIDDPDITAFTAIIQVGAVFATLL YFRHDFRRLLAAWGRGVRDPAWREHPDYRFGWAVILGSIPIGLVGVAFKDQIETTLRSLW FVGGALILWSGVMGYADHVGTQKRHEEDVTWKDTLVIGIVQCMALIPGISRSGATMSAGL LRGLDRVAVTRLSFFLSIPALMAAAALQVLTKSDDIADGVGWPATIIATVVSFAVAYVAI AWLLKFIARHSYSVFIGYRLALGATVLFLVATGIVSAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase (T311), CF640R conjugate, 0.1mg/mL
BNC400012-500 1x 500 µL

Tyrosinase (T311), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL
BNC940266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL
BNC880352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL
BNC881231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF640R conjugate, 0.1mg/mL
BNC400745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL
BNC880218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details