Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanoculleus marisnigri Digeranylgeranylglyceryl phosphate synthase (Memar_1697)

This Recombinant Methanoculleus marisnigri Digeranylgeranylglyceryl phosphate synthase (Memar_1697) spans the amino acid sequence from region 1-279.

Product Specifications

Product Name Alternative

Digeranylgeranylglyceryl phosphate synthase, DGGGP synthase, DGGGPS, EC= 2.5.1.42, (S) -2,3-di-O-geranylgeranylglyceryl phosphate synthase, Geranylgeranylglycerol-ph

UniProt

A3CW74

Expression Region

1-279

Origin

Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVSAFIRITRPHNAVVAGLTALIGYLIATGTLTPPSLLLAVIVALITAGGNVINDVRDV EIDRINRPDRPIPAGDISLAGARAYAAALFVGGIAIATLTTTLCLAIAIINSVILIVYAV RLKRTPVLGNVAVAYLAGSVFLFGGAFAGIEGLVRNLSLAAITFLATIARELLKDAEDVD GDAAGGARTLPMIVGVRKTGIFAFACACGAVAASLLPFGDWWGLFYLAGIAVVDLVILFG AFRGLSCTTPGCVRESNATSILRAGMFAALAVFAIAAVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF alpha (J2D10), CF488A conjugate, 0.1mg/mL
BNC880994-100 1x 100 µL

TNF alpha (J2D10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL
BNC680806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL
BNC740029-500 1x 500 µL

Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL
BNC680630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF640R conjugate, 0.1mg/mL
BNC400324-500 1x 500 µL

CD53 (161-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (C68/684), CF740 conjugate, 0.1mg/mL
BNC740684-500 1x 500 µL

CD68 (C68/684), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details