Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Undecaprenyl-diphosphatase (uppP)

This Recombinant Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-279.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q3K3N4

Expression Region

1-279

Origin

Streptococcus agalactiae serotype Ia

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLIIELLKALFLGVVEGVTEWLPVSSTGHLILVQEFMKLNQSKSFVEMFNIVIQLGAIMA VIVIYFKRLNPFQPGKSAREIRLTWQLWLKVVIACIPSILIALPFDNWFEAHFNFMIPIA IALIFYGFVFIWVEKRNAHLKPQVTELASMSYKTAFLIGCFQVLSIVPGTSRSGATILGA IIIGTSRSVAADFTFFLAIPTMFGYSGLKAVKYFLDGNVLSLDQSLILLVASLIAFVVSL YVIRFLTDYVKRHDFTIFGKYRIVLGSLLILYWLVVHLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Violet 540 Anti-Human CD4 Antibody[SK3]
E-AB-F1352T3-01 20 Tests

Elab Fluor® Violet 540 Anti-Human CD4 Antibody[SK3]

Sign In for Pricing
View Details
Elab Fluor® Violet 540 Anti-Human CD4 Antibody[SK3]
E-AB-F1352T3-02 100 Tests

Elab Fluor® Violet 540 Anti-Human CD4 Antibody[SK3]

Sign In for Pricing
View Details
Elab Fluor® Violet 540 Anti-Human CD4 Antibody[SK3]
E-AB-F1352T3-03 2x 100 Tests

Elab Fluor® Violet 540 Anti-Human CD4 Antibody[SK3]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Epidermal Growth Factor,  40nm
GM-42-40 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Epidermal Growth Factor, 40nm

Sign In for Pricing
View Details
4-Acetylamino-2-chlorophenol
TRC-A168175-1G 1 g

4-Acetylamino-2-chlorophenol

Sign In for Pricing
View Details
Tissue Genomic DNA, Colon: right
CD563642 5 µg

Tissue Genomic DNA, Colon: right

Sign In for Pricing
View Details