Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Undecaprenyl-diphosphatase (uppP)

This Recombinant Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-279.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q3K3N4

Expression Region

1-279

Origin

Streptococcus agalactiae serotype Ia

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLIIELLKALFLGVVEGVTEWLPVSSTGHLILVQEFMKLNQSKSFVEMFNIVIQLGAIMA VIVIYFKRLNPFQPGKSAREIRLTWQLWLKVVIACIPSILIALPFDNWFEAHFNFMIPIA IALIFYGFVFIWVEKRNAHLKPQVTELASMSYKTAFLIGCFQVLSIVPGTSRSGATILGA IIIGTSRSVAADFTFFLAIPTMFGYSGLKAVKYFLDGNVLSLDQSLILLVASLIAFVVSL YVIRFLTDYVKRHDFTIFGKYRIVLGSLLILYWLVVHLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF115 Antibody
KC-26426-01 50 μL

RNF115 Antibody

Sign In for Pricing
View Details
RNF115 Antibody
KC-26426-02 100 µL

RNF115 Antibody

Sign In for Pricing
View Details
RNF115 Antibody
KC-26426-03 1 mL

RNF115 Antibody

Sign In for Pricing
View Details
CSHL1 (C-term) Rabbit Polyclonal Antibody
AP51100PU-N 400 µL

CSHL1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
T-bet Rabbit Polyclonal Antibody
ER1802-65 100 µL

T-bet Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast, left
CS714063 5x 5 µm

Tissue FFPE Sections, Breast, left

Sign In for Pricing
View Details