Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Undecaprenyl-diphosphatase (uppP)

This Recombinant Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-279.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q8E260

Expression Region

1-279

Origin

Streptococcus agalactiae serotype V

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLIIELLKALFLGVVEGVTEWLPVSSTGHLILVQEFMKLNQSKSFVEMFNIVIQLGAIMA VIVIYFKRLNPFQPGKSAREIRLTWQLWLKVVIACIPSILIALPFDNWFEAHFNFMIPIA IALIFYGFVFIWVEKRNAHLKPQVTELASMSYKTAFLIGCFQVLSIVPGTSRSGATILGA IIIGTSRSVAADFTFFLAIPTMFGYSGLKAVKYFLDGNVLSLDQSLILLVASLTAFVVSL YVIRFLTDYVKRHDFTIFGKYRIVLGSLLILYWLVVHLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tcfap2c sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3820707 1.0 µg DNA

Tcfap2c sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
TAGLN Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV681594 1.0 µg DNA

TAGLN Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
RGD1306583 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV653329 1.0 µg DNA

RGD1306583 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
MMP11 (Matrix Metalloproteinase 11, ST3, SL-3, STMY3) (HRP)
MBS6426896-01 0.1 mL

MMP11 (Matrix Metalloproteinase 11, ST3, SL-3, STMY3) (HRP)

Sign In for Pricing
View Details
MMP11 (Matrix Metalloproteinase 11, ST3, SL-3, STMY3) (HRP)
MBS6426896-02 5x 0.1 mL

MMP11 (Matrix Metalloproteinase 11, ST3, SL-3, STMY3) (HRP)

Sign In for Pricing
View Details
POU6F2 shRNA (m) Lentiviral Particles
sc-152394-V 200 µL

POU6F2 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details