Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Putative uncharacterized transporter HI_0585 (HI_0585)

This Recombinant Haemophilus influenzae Putative uncharacterized transporter HI_0585 (HI_0585) spans the amino acid sequence from region 1-279.

Product Specifications

Product Name Alternative

Putative uncharacterized transporter HI_0585

UniProt

P44018

Expression Region

1-279

Origin

Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMSPGSSHSAMISEMSGLTITQVNLSHAPYNMIAGAIGAVVLTILALVFKDYGEQHRQAY LAEQKESEIKVIEGVNVLYALAPLIPLVILVIGGTSLQQVPGLEWTKMGVPQAMLIGAIY GIIVTRISPVKITEEFFNGMGNSYANVLGIIIAASVFVAGLKSTGAVDAAISFLKESNEF VRWGATIGPFLMGLITGSGDAAAIAFNTAVTPHAVELGYTHVNLGMAAAIAGAIGRTASP IAGVTIVCAGLAMVSPVEMVKRTAPGMILAVLFLALFML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF740 conjugate, 0.1mg/mL
BNC740871-100 1x 100 µL

CD71 (66IG10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL
BNC740040-500 1x 500 µL

CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF740 conjugate, 0.1mg/mL
BNC740861-500 1x 500 µL

HSP27 (G3.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL
BNC400034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL
BNC402853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PSA (Prostate Specific Antigen) (A67-B/E3), CF594 conjugate, 0.1mg/mL
BNC940883-500 1x 500 µL

PSA (Prostate Specific Antigen) (A67-B/E3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details