Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae Maltodextrin transport system permease protein malD (malD)

This Recombinant Streptococcus pneumoniae Maltodextrin transport system permease protein malD (malD) spans the amino acid sequence from region 1-280.

Product Specifications

Product Name Alternative

Maltodextrin transport system permease protein malD

UniProt

P0A4N4

Expression Region

1-280

Origin

Streptococcus pneumoniae (strain ATCC BAA-255 / R6)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNSIKLKRRLTQSLTYLYLIGLSIVIIYPLLITIMSAFKAGNVSAFKLDTNIDLNFDNF KGLFTETLYGTWYLNTLIIALITMAVQTSIIVLAGYAYSRYNFLARKQSLVFFLIIQMVP TMAALTAFFVMALMLNALNHNWFLIFLYVGGGIPMNAWLMKGYFDTVPMSLDESAKLDGA GHFRRFWQIVLPLVRPMVAVQALWAFMGPFGDYILSSFLLREKEYFTVAVGLQTFVNNAK NLKIAYFSAGAILIALPICILFFFLQKNFVSGLTSGGDKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phomopsis viticola TaqMan PCR Kit
TM34950 100 Reactions

Phomopsis viticola TaqMan PCR Kit

Sign In for Pricing
View Details
HOXD8 Antibody
KC-3207-01 50 μL

HOXD8 Antibody

Sign In for Pricing
View Details
HOXD8 Antibody
KC-3207-02 100 µL

HOXD8 Antibody

Sign In for Pricing
View Details
HOXD8 Antibody
KC-3207-03 1 mL

HOXD8 Antibody

Sign In for Pricing
View Details
Human DDX19A activation kit by CRISPRa
GA110691 1 Kit

Human DDX19A activation kit by CRISPRa

Sign In for Pricing
View Details
Naloxone Hydrochloride
TRC-N285000-250MG 250 mg

Naloxone Hydrochloride

Sign In for Pricing
View Details