Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Maltodextrin transport system permease protein malD (malD)

This Recombinant Maltodextrin transport system permease protein malD (malD) spans the amino acid sequence from region 1-280.

Product Specifications

Product Name Alternative

Maltodextrin transport system permease protein malD

UniProt

P0A4N3

Expression Region

1-280

Origin

Streptococcus pneumoniae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNSIKLKRRLTQSLTYLYLIGLSIVIIYPLLITIMSAFKAGNVSAFKLDTNIDLNFDNF KGLFTETLYGTWYLNTLIIALITMAVQTSIIVLAGYAYSRYNFLARKQSLVFFLIIQMVP TMAALTAFFVMALMLNALNHNWFLIFLYVGGGIPMNAWLMKGYFDTVPMSLDESAKLDGA GHFRRFWQIVLPLVRPMVAVQALWAFMGPFGDYILSSFLLREKEYFTVAVGLQTFVNNAK NLKIAYFSAGAILIALPICILFFFLQKNFVSGLTSGGDKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TUBA3E Antibody, FITC conjugated
A58773-50UG 50 µg

TUBA3E Antibody, FITC conjugated

Sign In for Pricing
View Details
Anti-Phospho-Zyxin (S142) antibody
STJ90641 200 µl

Anti-Phospho-Zyxin (S142) antibody

Sign In for Pricing
View Details
Lysosome Associated Membrane Protein 1 (LAMP 1, CD107a, Igp120, IgpA) (PE)
048677-01 50 µg

Lysosome Associated Membrane Protein 1 (LAMP 1, CD107a, Igp120, IgpA) (PE)

Sign In for Pricing
View Details
Lysosome Associated Membrane Protein 1 (LAMP 1, CD107a, Igp120, IgpA) (PE)
048677-02 200 µg

Lysosome Associated Membrane Protein 1 (LAMP 1, CD107a, Igp120, IgpA) (PE)

Sign In for Pricing
View Details
Polyclonal HOXC8 antibody - middle region
APR00841G 0.05mg

Polyclonal HOXC8 antibody - middle region

Sign In for Pricing
View Details
Goat anti-Hepatitis B Virus E Antigen Antibody-FITC labeled
YLD8365-01 50 µL

Goat anti-Hepatitis B Virus E Antigen Antibody-FITC labeled

Sign In for Pricing
View Details