Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative aquaporin-10 (aqp-10)

This Recombinant Putative aquaporin-10 (aqp-10) spans the amino acid sequence from region 1-280.

Product Specifications

Product Name Alternative

Putative aquaporin-10

UniProt

Q09369

Expression Region

1-280

Origin

Caenorhabditis elegans

Field of Research

Kidney & Urological Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAVSSEYYFPLYSALGYFALVFGIGEIARIITAKYVSPRGNSQLFLYELIGTIQMCTCV YENGIIFKNYGFPAIFICVALLLTAGNIFNRGAMTNCAPIFEQFVFGNLGSSKFLTILSA QLIGATFASKFAYLIWNITAPYSTAHLENASNLECILHYKQTAGIVIGFEIVGAFVVRIV VAQLLARPALIKLIPFAISAYLSLALYVVGVPGLNPIVATARLYGCRGIDNSSFFILYWF CPVLGWLTGAYVVGQKSPSKKSAKDVKAEKKAKAAAKKSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF568 conjugate, 0.1mg/mL
BNC680333-500 1x 500 µL

CD8 (RIV11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF488A conjugate, 0.1mg/mL
BNC880164-100 1x 100 µL

CD28 (204.12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF740 conjugate, 0.1mg/mL
BNC740645-100 1x 100 µL

FOXP3 (3G3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/798), CF647 conjugate, 0.1mg/mL
BNC471917-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/798), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PCNA (PCNA/694), CF647 conjugate, 0.1mg/mL
BNC470694-100 1x 100 µL

PCNA (PCNA/694), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (C66/195), CF640R conjugate, 0.1mg/mL
BNC400195-500 1x 500 µL

CD66 (CEA) (C66/195), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details