Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanosarcina barkeri Cobalamin synthase (cobS)

This Recombinant Methanosarcina barkeri Cobalamin synthase (cobS) spans the amino acid sequence from region 1-280.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q465W3

Expression Region

1-280

Origin

Methanosarcina barkeri (strain Fusaro / DSM 804)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSYLLAFKSGFGFLSTIPVGISMEGIDELMKKIYFYPVVGAVLGLLIGAVAFIGQVIFP GPVLAALLMGFIYYITGFNHLDGITDIGDGFMAHGSLEKKIKALKDTTIGTGGVSFCILL LLTLYGSIRAVQQEGSAVFGSNLPVLMFESMFIAEVSAKQSMLTIAAFGKPIPPREKQAY PGLGAMTINGATRKNFLIGFVFGAIVCFLPFGWIGLLPYLGACLVALVILNRSYAHFGGL NGDGIGTANEIGRVTALIILAVLLQLSLNGYMGGFKWTLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Levosimendan Triazene Impurity
TRC-L378010-25MG 25 mg

Levosimendan Triazene Impurity

Sign In for Pricing
View Details
Human DPY30 activation kit by CRISPRa
GA113637 1 Kit

Human DPY30 activation kit by CRISPRa

Sign In for Pricing
View Details
AzoDye-2 CPG (1000 A)
2430-AAT 100 mg

AzoDye-2 CPG (1000 A)

Sign In for Pricing
View Details
Galanin (GAL) Human Gene Knockout Kit (CRISPR)
KN207053 1 Kit

Galanin (GAL) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Slc4a4 Mouse Gene Knockout Kit (CRISPR)
KN516144 1 Kit

Slc4a4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD36 (Platelet & Microvessel Marker) (GPIIIb/1654), CF488A conjugate, 0.1mg/mL
BNC881654-500 1x 500 µL

CD36 (Platelet & Microvessel Marker) (GPIIIb/1654), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details