Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida Phosphate transport system permease protein pstA (pstA)

This Recombinant Pasteurella multocida Phosphate transport system permease protein pstA (pstA) spans the amino acid sequence from region 1-280.

Product Specifications

Product Name Alternative

Phosphate transport system permease protein pstA

UniProt

Q9CNJ6

Expression Region

1-280

Origin

Pasteurella multocida (strain Pm70)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNTHFHCRKLKNKLMLTLSFLAVFFGLFWLCWILFTLITKGIPALSLELFLEKTPGPGE KGGLLNAIIGSTLMITVSTLIGTPIGILAGTYLAEYGRYSQLTKVTRFLNDVLLSAPSIV IGLFIYAIYVSQVKHYSGWAGAFALAIIIIPVVVRTTDNMLNLVPNNLREAAASLGCPQW RVITMICYRSARAGILTGVLLSIARISGETAPLLFTALSNQFTSFDMNGPMANIPIVIYQ FAASPFQDWNELAWAGATLITLFVLLLNIFARIFFPQKSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPS35 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
30587064 1.0 µg DNA

MRPS35 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
CYP26A1 Blocking Peptide
MBS9617079-01 1 mg

CYP26A1 Blocking Peptide

Sign In for Pricing
View Details
CYP26A1 Blocking Peptide
MBS9617079-02 5x 1 mg

CYP26A1 Blocking Peptide

Sign In for Pricing
View Details
C1orf77 3'UTR GFP Stable Cell Line
TU052035 1.0 mL

C1orf77 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Sheep G protein activated inward rectifier potassium channel 4 (KCNJ5) ELISA Kit
GTR10314921 96 Well

Sheep G protein activated inward rectifier potassium channel 4 (KCNJ5) ELISA Kit

Sign In for Pricing
View Details
LONP2 shRNA (m) Lentiviral Particles
sc-149013-V 200 µL

LONP2 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details