Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida Phosphate transport system permease protein pstA (pstA)

This Recombinant Pasteurella multocida Phosphate transport system permease protein pstA (pstA) spans the amino acid sequence from region 1-280.

Product Specifications

Product Name Alternative

Phosphate transport system permease protein pstA

UniProt

Q9CNJ6

Expression Region

1-280

Origin

Pasteurella multocida (strain Pm70)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNTHFHCRKLKNKLMLTLSFLAVFFGLFWLCWILFTLITKGIPALSLELFLEKTPGPGE KGGLLNAIIGSTLMITVSTLIGTPIGILAGTYLAEYGRYSQLTKVTRFLNDVLLSAPSIV IGLFIYAIYVSQVKHYSGWAGAFALAIIIIPVVVRTTDNMLNLVPNNLREAAASLGCPQW RVITMICYRSARAGILTGVLLSIARISGETAPLLFTALSNQFTSFDMNGPMANIPIVIYQ FAASPFQDWNELAWAGATLITLFVLLLNIFARIFFPQKSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aconitate Hydratase, Mitochondrial (ACO2) Peptide
abx616168 100 µg

Aconitate Hydratase, Mitochondrial (ACO2) Peptide

Sign In for Pricing
View Details
PLEKHA1 Recombinant Protein
OPCD06267-10UG 10 µg

PLEKHA1 Recombinant Protein

Sign In for Pricing
View Details
Genotyping of neisseria meningitidis
K248 100 Reactions

Genotyping of neisseria meningitidis

Sign In for Pricing
View Details
Genorise® recombinant Mouse 14-3-3 eta protein
GR124157 5 µg

Genorise® recombinant Mouse 14-3-3 eta protein

Sign In for Pricing
View Details
Mouse WNT2 (Wingless Type MMTV Integration Site Family, Member 2) ELISA Kit
MBS8807294-01 48 Well

Mouse WNT2 (Wingless Type MMTV Integration Site Family, Member 2) ELISA Kit

Sign In for Pricing
View Details
Mouse WNT2 (Wingless Type MMTV Integration Site Family, Member 2) ELISA Kit
MBS8807294-02 96 Well

Mouse WNT2 (Wingless Type MMTV Integration Site Family, Member 2) ELISA Kit

Sign In for Pricing
View Details