Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida Phosphate transport system permease protein pstA (pstA)

This Recombinant Pasteurella multocida Phosphate transport system permease protein pstA (pstA) spans the amino acid sequence from region 1-280.

Product Specifications

Product Name Alternative

Phosphate transport system permease protein pstA

UniProt

Q9CNJ6

Expression Region

1-280

Origin

Pasteurella multocida (strain Pm70)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNTHFHCRKLKNKLMLTLSFLAVFFGLFWLCWILFTLITKGIPALSLELFLEKTPGPGE KGGLLNAIIGSTLMITVSTLIGTPIGILAGTYLAEYGRYSQLTKVTRFLNDVLLSAPSIV IGLFIYAIYVSQVKHYSGWAGAFALAIIIIPVVVRTTDNMLNLVPNNLREAAASLGCPQW RVITMICYRSARAGILTGVLLSIARISGETAPLLFTALSNQFTSFDMNGPMANIPIVIYQ FAASPFQDWNELAWAGATLITLFVLLLNIFARIFFPQKSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CDK6 (Ab-13)
orb1139573 100 µg

Anti-CDK6 (Ab-13)

Sign In for Pricing
View Details
Anti-CD64/FCGR1A Antibody (R1N66)
RHC93403 100 μg

Anti-CD64/FCGR1A Antibody (R1N66)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Argininosuccinate synthase (argG)
MBS1080541-01 0.02 mg (E-Coli)

Recombinant Synechococcus sp. Argininosuccinate synthase (argG)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Argininosuccinate synthase (argG)
MBS1080541-02 0.02 mg (Yeast)

Recombinant Synechococcus sp. Argininosuccinate synthase (argG)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Argininosuccinate synthase (argG)
MBS1080541-03 0.1 mg (E-Coli)

Recombinant Synechococcus sp. Argininosuccinate synthase (argG)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Argininosuccinate synthase (argG)
MBS1080541-04 0.1 mg (Yeast)

Recombinant Synechococcus sp. Argininosuccinate synthase (argG)

Sign In for Pricing
View Details