Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Uncharacterized tatC-like protein ymf16 (YMF16)

This Recombinant Arabidopsis thaliana Uncharacterized tatC-like protein ymf16 (YMF16) spans the amino acid sequence from region 1-280.

Product Specifications

Product Name Alternative

Uncharacterized tatC-like protein ymf16, ORFX

UniProt

P93312

Expression Region

1-280

Origin

Arabidopsis thaliana (Mouse-ear cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNYLYISYEFNFALETILGEVRIRSVRILIGLGLTWFTCYWFSEELIFLLALPFLTLPFD LYFVCTQLTEAFSTFVATSSIACSYFVFPLISYQIWCFLIPSCYGEQRTKYNRFFYLSGF CFFLFLFLTLSWVVPNVWHFLYFVGATSTNSLMIKLQPKIYDYIMLTVRISFISSVCSQV PVIVICLLEPRGLSLETFTNNRRFLMVFSLLTAALFTPPDIWCQIVACFLISLIIELAIF VALIVQVREEGWTSGMRESGSIEKKNKSSPPPRTWQSNYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL
BNC680034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF740 conjugate, 0.1mg/mL
BNC740322-100 1x 100 µL

CD3e (RIV9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF594 conjugate, 0.1mg/mL
BNC940861-500 1x 500 µL

HSP27 (G3.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL
BNC680149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF568 conjugate, 0.1mg/mL
BNC680012-500 1x 500 µL

Tyrosinase (T311), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF640R conjugate, 0.1mg/mL
BNC400745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details