Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycerol uptake facilitator protein (glpF)

This Recombinant Glycerol uptake facilitator protein (glpF) spans the amino acid sequence from region 1-281.

Product Specifications

Product Name Alternative

Glycerol uptake facilitator protein, Aquaglyceroporin

UniProt

P0AER1

Expression Region

1-281

Origin

Escherichia coli O6

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQTSTLKGQCIAEFLGTGLLIFFGVGCVAALKVAGASFGQWEISVIWGLGVAMAIYLTA GVSGAHLNPAVTIALWLFACFDKRKVIPFIVSQVAGAFCAAALVYGLYYNLFFDFEQTHH IVRGSVESVDLAGTFSTYPNPHINFVQAFAVEMVITAILMGLILALTDDGNGVPRGPLAP LLIGLLIAVIGASMGPLTGFAMNPARDFGPKVFAWLAGWGNVAFTGGRDIPYFLVPLFGP IVGAIVGAFAYRKLIGRHLPCDICVVEEKETTTPSEQKASL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL
BNC040226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL
BNC940253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL
BNC040008-500 1x 500 µL

MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL
BNC040029-500 1x 500 µL

Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF680R conjugate, 0.1mg/mL
BNC810322-100 1x 100 µL

CD3e (RIV9), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF405S conjugate, 0.1mg/mL
BNC040151-100 1x 100 µL

CD11a (Cris-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details