Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B sn-glycerol-3-phosphate transport system permease protein ugpE (ugpE)

This Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B sn-glycerol-3-phosphate transport system permease protein ugpE (ugpE) spans the amino acid sequence from region 1-281.

Product Specifications

Product Name Alternative

Sn-glycerol-3-phosphate transport system permease protein ugpE

UniProt

A1JID9

Expression Region

1-281

Origin

Yersinia enterocolitica serotype O:8 / biotype 1B (strain 8081)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIENRRGLDIFCHVMLIIGVLLILFPLYVAFVAASLDDTQVFQVPMTLIPGPHLWQNISH IWHAGVGNNSAPFGLMLFNSFVMAFAITVGKITVSMLSAYAIVYFRFPLRNLFFWLIFLT LMLPVEVRIFPTIQVIANLNMLDSYTGLTLPLMASATATFLFRQFFMTLPDELLEAARID GAGAMRFFWDIVLPLSKTNLAALFVITFIYGWNQYLWPILITSDASMGTAVAGIRSMISS SGAPTQWNQVMAAMILTLIPPVAVVLLMQRWFVRGLVDSEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL
BNC940679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF488A conjugate, 0.1mg/mL
BNC880176-100 1x 100 µL

CD5 (Cris-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF568 conjugate, 0.1mg/mL
BNC680193-500 1x 500 µL

CD86 (BU63), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (MUC1/845), CF647 conjugate, 0.1mg/mL
BNC470845-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (MUC1/845), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GLG1 (Golgi Complex) (GLG1/970), CF488A conjugate, 0.1mg/mL
BNC880970-500 1x 500 µL

GLG1 (Golgi Complex) (GLG1/970), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/1859R), CF594 conjugate, 0.1mg/mL
BNC941859-500 1x 500 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/1859R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details