Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella flexneri serotype 5b sn-glycerol-3-phosphate transport system permease protein ugpE (ugpE)

This Recombinant Shigella flexneri serotype 5b sn-glycerol-3-phosphate transport system permease protein ugpE (ugpE) spans the amino acid sequence from region 1-281.

Product Specifications

Product Name Alternative

Sn-glycerol-3-phosphate transport system permease protein ugpE

UniProt

Q0SZM1

Expression Region

1-281

Origin

Shigella flexneri serotype 5b (strain 8401)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIENRPWLTIFSHTMLILGIAVILFPLYVAFVAATLDKQAVYAAPMTLIPGTHLLENIHN IWVNGVGTNSAPFWRMLLNSFVMAFSITLGKITVSMLSAFAIVWFRFPLRNLFFWMIFIT LMLPVEVRIFPTVEVIANLKMLDSYAGLTLPLMASAIATFLFRQFFMTLPDELVEAARID GASPMRFFCDIVFPLSKTNLAALFVITFIYGWNQYLWPLLIITDVDLGTTVAGIKGMIAT GEGTTEWNSVMAAMLLTLIPPVVIVLVMQRAFVRGLVDSEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL
BNC470031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL
BNC040225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL
BNC880158-500 1x 500 µL

Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL
BNC740437-100 1x 100 µL

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM (123C3.D5), CF405S conjugate, 0.1mg/mL
BNC040015-100 1x 100 µL

CD56 / NCAM (123C3.D5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66, pan (CEA) (Cocktail), CF647 conjugate, 0.1mg/mL
BNC471139-500 1x 500 µL

CD66, pan (CEA) (Cocktail), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details