Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella choleraesuis sn-glycerol-3-phosphate transport system permease protein ugpE (ugpE)

This Recombinant Salmonella choleraesuis sn-glycerol-3-phosphate transport system permease protein ugpE (ugpE) spans the amino acid sequence from region 1-281.

Product Specifications

Product Name Alternative

Sn-glycerol-3-phosphate transport system permease protein ugpE

UniProt

Q57IS2

Expression Region

1-281

Origin

Salmonella choleraesuis (strain SC-B67)

Field of Research

Infectious Disease & Virology; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIENRRGLTIFSHTMLILGIAVILFPLYVAFVAATLDDRAVFETPMTLLPGTQLLENIKT IWVNGVGVNSAPFWLMMLNSFIMAFSITVGKITVSMLSAFAIVWFRFPLRNLFFWMIFIT LMLPVEVRIFPTVEVIANLKMLDSYAGLTLPLMASATATFLFRQFFMTLPDELVEAARID GASPMRFFRDIVLPLSKTNLAALFVITFIYGWNQYLWPLLIITDVNLGTAVAGIKGMIAT GEGTTQWNQVMAAMLLTLIPPVVIVLAMQRAFVRGLVDSEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL
BNC880225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF405S conjugate, 0.1mg/mL
BNC040322-500 1x 500 µL

CD3e (RIV9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (HH1/957), CF405S conjugate, 0.1mg/mL
BNC040957-500 1x 500 µL

Histone H1 (HH1/957), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (Astrocyte & Neural Stem Cell Marker) (rASTRO/789), CF488A conjugate, 0.1mg/mL
BNC882227-100 1x 100 µL

GFAP (Astrocyte & Neural Stem Cell Marker) (rASTRO/789), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SIGLEC1 / CD169 / Sialoadhesin (HSn 7D2), CF405S conjugate, 0.1mg/mL
BNC042843-500 1x 500 µL

SIGLEC1 / CD169 / Sialoadhesin (HSn 7D2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 5/8 (C-50), CF405S conjugate, 0.1mg/mL
BNC040948-100 1x 100 µL

Cytokeratin 5/8 (C-50), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details