Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A sn-glycerol-3-phosphate transport system permease protein ugpE (ugpE)

This Recombinant Salmonella paratyphi A sn-glycerol-3-phosphate transport system permease protein ugpE (ugpE) spans the amino acid sequence from region 1-281.

Product Specifications

Product Name Alternative

Sn-glycerol-3-phosphate transport system permease protein ugpE

UniProt

Q5PJL0

Expression Region

1-281

Origin

Salmonella paratyphi A (strain ATCC 9150 / SARB42)

Field of Research

Infectious Disease & Virology; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIENRRGLTIFSHTMLILGIAVILFPLYVAFVAATLDDRAVFETPMTLLPGTQLLENIKT IWVNGVGVNSAPFWLMMLNSFIMAFSITVGKITVSMLSAFAIVWFRFPLRNLFFWMIFIT LMLPVEVRIFPTVEVIANLKMLDSYAGLTLPLMASATATFLFRQFFMTLPDELVEAARID GASPMRFFRDIVLPLSKTNLAALFVITFIYGWNQYLWPLLIITDVNLGTAVAGIKGMIAT GEGTTQWNQVMAAMLLTLIPPVVIVLAMQRAFVRGLVDSEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF568 conjugate, 0.1mg/mL
BNC680437-500 1x 500 µL

CD47 (B6H12.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL
BNC940257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL
BNC470460-500 1x 500 µL

CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glypican-3 (1G12), CF405S conjugate, 0.1mg/mL
BNC040862-100 1x 100 µL

Glypican-3 (1G12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL
BNC740276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (BCL6/850), CF405S conjugate, 0.1mg/mL
BNC040850-100 1x 100 µL

Bcl-6 (BCL6/850), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details