Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oenothera berteriana ATP synthase subunit a (ATP6)

This Recombinant Oenothera berteriana ATP synthase subunit a (ATP6) spans the amino acid sequence from region 1-281.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

P05500

Expression Region

1-281

Origin

Oenothera berteriana (Bertero's evening primrose) (Oenothera berteroana)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKRFYKTAFFSEIGSEEVSHFWADTMSSHSPLEQFSILPLIPMNIGNLYFSFTNSSLFML LTLSLVLLLVNFVTKKGGGNLVPNAWQSLVELIYDFVLNLVNEQIGGLSGNVKQKFFPCI LVTFTFLLFCNLQGMIPYSFTVTSHFLITLGLSFSIFIGITIVGFQRNGLHFLSFLLPAG VPLPLAPFLVLLELISYCFRALSLGIRLFANMMAGHSLVKILSGFAWTMLCMNDLFYFIG DLGPLFIVLALTGLELGVAILQAYVFTILICIYLNDAINLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (PCRP-CDX2-1A3), CF640R conjugate, 0.1mg/mL
BNC401920-100 1x 100 µL

CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (PCRP-CDX2-1A3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8b, Mouse (H35-17.2), CF594 conjugate, 0.1mg/mL
BNC942003-100 1x 100 µL

CD8b, Mouse (H35-17.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (Rabbit PAb), CF488A conjugate, 0.1mg/mL
BNC880385-500 1x 500 µL

CD3e (Rabbit PAb), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PS2 (GE2), CF740 conjugate, 0.1mg/mL
BNC740677-100 1x 100 µL

PS2 (GE2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (IAP/964 + B6H12.2), CF740 conjugate, 0.1mg/mL
BNC741029-100 1x 100 µL

CD47 (IAP/964 + B6H12.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), 0.2mg/mL
BNUB0871-100 1x 100 µL

CD71 (66IG10), 0.2mg/mL

Sign In for Pricing
View Details