Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycerol uptake facilitator protein (glpF)

This Recombinant Glycerol uptake facilitator protein (glpF) spans the amino acid sequence from region 1-281.

Product Specifications

Product Name Alternative

Glycerol uptake facilitator protein, Aquaglyceroporin

UniProt

P31140

Expression Region

1-281

Origin

Shigella flexneri

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQTSTLKGQCIAEFLGTGLLIFFGVGCVAALKVAGASFGQWEISVIWGLGVAMAIYLTA GVSGAHLNPAVTIALWLFACFDKRKVIPFIVSQVAGAFCAAALVYGLYYNLFFDFEQTHH IVRGSVESVDLAGTFSTYPNPHINFVQAFAVEMVITAILMGLILALTDDGNGVPRGPLAP LLIGLLIAVIGASMGPLTGFAMNPARDFGPKVFAWLAGWGNVAFTGGRDIPYFLVPLFSP IVGAIVGAFAYRKLIGRHLPCDICVVEEKETTTPSEQKASL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (G3.1), CF488A conjugate, 0.1mg/mL
BNC880861-500 1x 500 µL

HSP27 (G3.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MHC II (HLA-DQ) (SPV-L3), CF405M conjugate, 0.1mg/mL
BNC050200-500 1x 500 µL

MHC II (HLA-DQ) (SPV-L3), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rb1 (Tumor Suppressor Protein) (RB1/2313R), CF740 conjugate, 0.1mg/mL
BNC742313-500 1x 500 µL

Rb1 (Tumor Suppressor Protein) (RB1/2313R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nuclear Membrane (AE-5), CF640R conjugate, 0.1mg/mL
BNC400867-100 1x 100 µL

Nuclear Membrane (AE-5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GCDFP-15 (Gross Cystic Disease Fluid Protein 15) (Breast Marker) (PIP/1571), CF594 conjugate, 0.1mg/mL
BNC941571-500 1x 500 µL

GCDFP-15 (Gross Cystic Disease Fluid Protein 15) (Breast Marker) (PIP/1571), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (rKRT10/844), CF568 conjugate, 0.1mg/mL
BNC681989-500 1x 500 µL

Cytokeratin 10 (KRT10) (Suprabasal Epithelial Marker) (rKRT10/844), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details