Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Mb2352c (Mb2352c)

This Recombinant Uncharacterized protein Mb2352c (Mb2352c) spans the amino acid sequence from region 1-282.

Product Specifications

Product Name Alternative

Uncharacterized protein Mb2352c

UniProt

P64998

Expression Region

1-282

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTTSAPARNGTRRPSRPIVLLIPVPGSSVIHDLWAGTKLLVVFGISVLLTFYPGWVTIG MMAALVLAAARIAHIPRGALPSVPRWLWIVLAIGFLTAALAGGTPVVAVGGVQLGLGGAL HFLRITALSVVLLALGAMVSWTTNVAEISPAVATLGRPFRVLRIPVDEWAVALALALRAF PMLIDEFQVLYAARRLRPKRMPPSRKARRQRHARELIDLLAAAITVTLRRADEMGDAITA RGGTGQLSAHPGRPKLADWVTLAITAMASGTAVAIESLILHS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Neuropilin-1 (NRP1) (V179A)
CSB-MP016091HU (M)-01 20 µg

Recombinant Human Neuropilin-1 (NRP1) (V179A)

Sign In for Pricing
View Details
Recombinant Human Neuropilin-1 (NRP1) (V179A)
CSB-MP016091HU (M)-02 100 µg

Recombinant Human Neuropilin-1 (NRP1) (V179A)

Sign In for Pricing
View Details
Recombinant Human Neuropilin-1 (NRP1) (V179A)
CSB-MP016091HU (M)-03 1 mg

Recombinant Human Neuropilin-1 (NRP1) (V179A)

Sign In for Pricing
View Details
OPAN06666-100UG - Recombinant SARS-CoV-2 Spike S1 Protein
OPAN06666-100UG 100 µg

OPAN06666-100UG - Recombinant SARS-CoV-2 Spike S1 Protein

Sign In for Pricing
View Details
MEM With Earle's Salts , with L-glutamine
CM043-300 6x 500 mL

MEM With Earle's Salts , with L-glutamine

Sign In for Pricing
View Details
NR1H3 Antibody
MBS9507274-01 0.05 mL

NR1H3 Antibody

Sign In for Pricing
View Details