Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Mb2352c (Mb2352c)

This Recombinant Uncharacterized protein Mb2352c (Mb2352c) spans the amino acid sequence from region 1-282.

Product Specifications

Product Name Alternative

Uncharacterized protein Mb2352c

UniProt

P64998

Expression Region

1-282

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTTSAPARNGTRRPSRPIVLLIPVPGSSVIHDLWAGTKLLVVFGISVLLTFYPGWVTIG MMAALVLAAARIAHIPRGALPSVPRWLWIVLAIGFLTAALAGGTPVVAVGGVQLGLGGAL HFLRITALSVVLLALGAMVSWTTNVAEISPAVATLGRPFRVLRIPVDEWAVALALALRAF PMLIDEFQVLYAARRLRPKRMPPSRKARRQRHARELIDLLAAAITVTLRRADEMGDAITA RGGTGQLSAHPGRPKLADWVTLAITAMASGTAVAIESLILHS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,3,4-Trihydroxybenzaldehyde
GK3797-5g 5 g

2,3,4-Trihydroxybenzaldehyde

Sign In for Pricing
View Details
GAR1, ID (GAR1, NOLA1, H/ACA ribonucleoprotein complex subunit 1, Nucleolar protein family A member 1, snoRNP protein GAR1) (PE) discontinued
035913-PE 200 µL

GAR1, ID (GAR1, NOLA1, H/ACA ribonucleoprotein complex subunit 1, Nucleolar protein family A member 1, snoRNP protein GAR1) (PE) discontinued

Sign In for Pricing
View Details
Human CDKL1 Pre-designed siRNA Set B
SI002722B 1 Each

Human CDKL1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Zebrafish VEGFAB Rabbit Polyclonal Antibody (Fluoro647)
orb3091443 100 µg

Zebrafish VEGFAB Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Recombinant Escherichia coli O6:K15:H31 Elongation factor 4 (lepA)
MBS1487582-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O6:K15:H31 Elongation factor 4 (lepA)

Sign In for Pricing
View Details
Recombinant Escherichia coli O6:K15:H31 Elongation factor 4 (lepA)
MBS1487582-02 0.02 mg (Yeast)

Recombinant Escherichia coli O6:K15:H31 Elongation factor 4 (lepA)

Sign In for Pricing
View Details