Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Mb2352c (Mb2352c)

This Recombinant Uncharacterized protein Mb2352c (Mb2352c) spans the amino acid sequence from region 1-282.

Product Specifications

Product Name Alternative

Uncharacterized protein Mb2352c

UniProt

P64998

Expression Region

1-282

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTTSAPARNGTRRPSRPIVLLIPVPGSSVIHDLWAGTKLLVVFGISVLLTFYPGWVTIG MMAALVLAAARIAHIPRGALPSVPRWLWIVLAIGFLTAALAGGTPVVAVGGVQLGLGGAL HFLRITALSVVLLALGAMVSWTTNVAEISPAVATLGRPFRVLRIPVDEWAVALALALRAF PMLIDEFQVLYAARRLRPKRMPPSRKARRQRHARELIDLLAAAITVTLRRADEMGDAITA RGGTGQLSAHPGRPKLADWVTLAITAMASGTAVAIESLILHS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATG7 autophagy related 7 homolog (S. cerevisiae)
307138 100 µL

ATG7 autophagy related 7 homolog (S. cerevisiae)

Sign In for Pricing
View Details
OXSR1 Antibody (YA7860, Mouse)
HY-P88176 1 Each

OXSR1 Antibody (YA7860, Mouse)

Sign In for Pricing
View Details
ELISA Kit For Mesothelin
E2255r 96 Tests

ELISA Kit For Mesothelin

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Caspase 9 (CASP9)
TRV-0022456-01 200 µL

FITC-Linked Polyclonal Antibody to Caspase 9 (CASP9)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Caspase 9 (CASP9)
TRV-0022456-02 1 mL

FITC-Linked Polyclonal Antibody to Caspase 9 (CASP9)

Sign In for Pricing
View Details
SELPLG Protein Vector (Human) (pPM-C-His)
PV037288 500 ng

SELPLG Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details