Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium leprae Undecaprenyl-diphosphatase (uppP)

This Recombinant Mycobacterium leprae Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-282.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

B8ZRD4

Expression Region

1-282

Origin

Mycobacterium leprae (strain Br4923)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAVSAMSWWQVIVLAVVQGLTEFLPVSSSGHLAIVSRILFTGDAGASFTAVSQLGTEVA VLVYFGRDIVRILHAWCRGLTVTLHRTADYWLGWYVIIGTIPICILGLVCKDEIRSGIRP LWVVATALVAFSGVIAFAEYVGRQNRCIEQLNWRDALVVGVAQTLALIPGVSRSGSTISA GLFLGLDRELAARFGFLLAIPAVFASGLFSIPDAFHPITEGMSATGAQLLVATVIAFVVG LVAVSWLLRFLVQHNLYWFVGYRIVVGVGVLILLAVKTVAAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL
BNC040679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF640R conjugate, 0.1mg/mL
BNC400645-100 1x 100 µL

FOXP3 (3G3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL
BNC681231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL
BNC050391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD64 (10.1), CF640R conjugate, 0.1mg/mL
BNC402846-100 1x 100 µL

CD64 (10.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (Astrocyte & Neural Stem Cell Marker) (GFAP/2076), CF488A conjugate, 0.1mg/mL
BNC882076-100 1x 100 µL

GFAP (Astrocyte & Neural Stem Cell Marker) (GFAP/2076), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details