Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanoplanus petrolearius Protein translocase subunit SecF (secF)

This Recombinant Methanoplanus petrolearius Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-282.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

E1RHR2

Expression Region

1-282

Origin

Methanoplanus petrolearius (strain DSM 11571 / OCM 486 / SEBR 4847)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKFTYDINRYEPKQMVALPLCLLILSVIFLAFNTVSTGMPVEPGIDFAGGVAVTLSTSD SVDVIEDYFADYPLKISESDVAAGYLVFNYLEGDSFKDLTEHITARYPDATIYQMGETFG KTLQSQAIWALLFAFVLMAIVVFVAFRIFIPSVAVVLSAFSDIVITAAFMDVFGLTLSLG TTAALLMLIGYSVDSDVLLTTRLLKRQGKVDEKFRGAFRTGIIMTTTTLAAVVVMFIVFS LGQVTLIRDISAVLIIGLIIDMMNTWMLNAGLLKWYVKKGGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL
BNC040994-100 1x 100 µL

TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF647 conjugate, 0.1mg/mL
BNC470449-500 1x 500 µL

CD104 (UM-A9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL
BNC741050-500 1x 500 µL

CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF555 conjugate, 0.1mg/mL
BNC550645-500 1x 500 µL

FOXP3 (3G3), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF555 conjugate, 0.1mg/mL
BNC550039-500 1x 500 µL

CD34 (ICO-115), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL
BNC042216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details