Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Polaromonas sp. Cobalamin synthase (cobS)

This Recombinant Polaromonas sp. Cobalamin synthase (cobS) spans the amino acid sequence from region 1-282.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q12FJ6

Expression Region

1-282

Origin

Polaromonas sp. (strain JS666 / ATCC BAA-500)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPISQFVREYLLAVQFFTRIPVVGRLADWVGYSPELLRASAGHFPGVGILVGVMAALVY GLIQALLPNTPFTPLVAAVLSTAATVLLTGGFHEDGLADVADGLGGSQDRERALEIMKDS RVGAFGAMALMLALLGKTALLAMLGSVDVSPAELGDDASFSSWYIGAALLTGHVVSRGLP LLLIWLLPHVGNTASSKSKPLADQISQGSLLVAFIWSFVVLALAGLALDAISLIVACSFS LLALLWMGALFKRRLQGFTGDCLGATQQVCEIAFYLGLAVSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rp2 Mouse Gene Knockout Kit (CRISPR)
KN514992 1 Kit

Rp2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HSDL2 (NM_001195822) Human Over-expression Lysate
LY433809 100 µg

HSDL2 (NM_001195822) Human Over-expression Lysate

Sign In for Pricing
View Details
GLUT-1 (Tumor Progression and Mesothelioma Marker) (rGLUT1/2476), CF405S conjugate, 0.1mg/mL
BNC043795-100 1x 100 µL

GLUT-1 (Tumor Progression and Mesothelioma Marker) (rGLUT1/2476), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MTH1 (NUDT1) (NM_002452) Human Over-expression Lysate
LC429104 20 µg

MTH1 (NUDT1) (NM_002452) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS624177 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
TBC1D22A (C-term) Rabbit Polyclonal Antibody
AP54167PU-N 400 µL

TBC1D22A (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details