Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Polaromonas sp. Cobalamin synthase (cobS)

This Recombinant Polaromonas sp. Cobalamin synthase (cobS) spans the amino acid sequence from region 1-282.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q12FJ6

Expression Region

1-282

Origin

Polaromonas sp. (strain JS666 / ATCC BAA-500)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPISQFVREYLLAVQFFTRIPVVGRLADWVGYSPELLRASAGHFPGVGILVGVMAALVY GLIQALLPNTPFTPLVAAVLSTAATVLLTGGFHEDGLADVADGLGGSQDRERALEIMKDS RVGAFGAMALMLALLGKTALLAMLGSVDVSPAELGDDASFSSWYIGAALLTGHVVSRGLP LLLIWLLPHVGNTASSKSKPLADQISQGSLLVAFIWSFVVLALAGLALDAISLIVACSFS LLALLWMGALFKRRLQGFTGDCLGATQQVCEIAFYLGLAVSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diphenylphosphinic Chloride
TRC-D492095-5G 5 g

Diphenylphosphinic Chloride

Sign In for Pricing
View Details
5-Delta-Bromobutylhydantoin
TRC-B682000-2G 2 g

5-Delta-Bromobutylhydantoin

Sign In for Pricing
View Details
Human Hsp22 (HSPB8) activation kit by CRISPRa
GA108860 1 Kit

Human Hsp22 (HSPB8) activation kit by CRISPRa

Sign In for Pricing
View Details
Arrdc3 Mouse Gene Knockout Kit (CRISPR)
KN501620 1 Kit

Arrdc3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AntiFixTM Universal Antigen Retreival Buffer, 10X, 50 mL
#22030-50mL 1x 50 mL

AntiFixTM Universal Antigen Retreival Buffer, 10X, 50 mL

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (SPN/1766R), CF568 conjugate, 0.1mg/mL
BNC681766-500 1x 500 µL

CD43 (T-Cell Marker) (SPN/1766R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details