Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Polaromonas sp. Cobalamin synthase (cobS)

This Recombinant Polaromonas sp. Cobalamin synthase (cobS) spans the amino acid sequence from region 1-282.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q12FJ6

Expression Region

1-282

Origin

Polaromonas sp. (strain JS666 / ATCC BAA-500)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPISQFVREYLLAVQFFTRIPVVGRLADWVGYSPELLRASAGHFPGVGILVGVMAALVY GLIQALLPNTPFTPLVAAVLSTAATVLLTGGFHEDGLADVADGLGGSQDRERALEIMKDS RVGAFGAMALMLALLGKTALLAMLGSVDVSPAELGDDASFSSWYIGAALLTGHVVSRGLP LLLIWLLPHVGNTASSKSKPLADQISQGSLLVAFIWSFVVLALAGLALDAISLIVACSFS LLALLWMGALFKRRLQGFTGDCLGATQQVCEIAFYLGLAVSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRCC2 (BLID) (NM_001001786) Human Over-expression Lysate
LC424226 20 µg

BRCC2 (BLID) (NM_001001786) Human Over-expression Lysate

Sign In for Pricing
View Details
Helixyte™ Green NHS ester
17612-AAT 1 mg

Helixyte™ Green NHS ester

Sign In for Pricing
View Details
(11b,16a)-11,16-Dihydroxyandrosta-1,4-diene-3,17-dione
TRC-D455560-50MG 50 mg

(11b,16a)-11,16-Dihydroxyandrosta-1,4-diene-3,17-dione

Sign In for Pricing
View Details
Acsm5 Mouse Gene Knockout Kit (CRISPR)
KN500766 1 Kit

Acsm5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HER-2 / CD340 (HRB2/282), CF488A conjugate, 0.1mg/mL
BNC880282-500 1x 500 µL

HER-2 / CD340 (HRB2/282), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS712773 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details